PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G09300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 319aa    MW: 35868.8 Da    PI: 6.7819
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G09300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l  +++++G g+W+  ++  g++R++k+c++rw +yl
  OMERI06G09300.1 14 KGPWTPEEDEKLMSYIQKHGRGSWRVLPELAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.31.5e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  OMERI06G09300.1  67 RGNFSREEEQTILQLHSILGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.997961IPR017930Myb domain
SuperFamilySSF466895.99E-3211108IPR009057Homeodomain-like
SMARTSM007171.2E-141363IPR001005SANT/Myb domain
PfamPF002494.6E-171461IPR001005SANT/Myb domain
CDDcd001674.11E-111661No hitNo description
PROSITE profilePS5129427.17662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2765117IPR009057Homeodomain-like
SMARTSM007172.7E-1766114IPR001005SANT/Myb domain
PfamPF002492.2E-1667112IPR001005SANT/Myb domain
CDDcd001677.97E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGRPPCCDEN GLKKGPWTPE EDEKLMSYIQ KHGRGSWRVL PELAGLNRCG KSCRLRWTNY  60
LKPDLKRGNF SREEEQTILQ LHSILGNKWS AIAKHLPGRT DNEIKNFWNT HLRKKLIKMG  120
IDPMTHRPRT DFFQSLPQLI ALANLRQIIE RQPWDGHIEG LQTVAVQAAK LNYVQSLLHS  180
AVSIVTSPTT TTSSLNTFTT ELEQTNHLCP PQVPSSSVPE LAVQVPHSQM PSTSFDQEIG  240
KTNLFSNNIV NGNEWCSMEA DNSSQKSLLV PENSVPPLID MPVQNLCNTI STPNRDGGNS  300
IPLPSWSEIL LDELMDEFA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-29121162105C-Myb DNA-Binding Domain
1mse_C2e-29121162105C-Myb DNA-Binding Domain
1gv2_A2e-29121162105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644332.10.0PREDICTED: myb-related protein 330
SwissprotQ8GWP05e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0E0DZ800.0A0A0E0DZ80_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g11780.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-97myb domain protein 93